PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01015035001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family ARF
Protein Properties Length: 879aa    MW: 97290.5 Da    PI: 6.6563
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01015035001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.72.2e-23126227199
                        EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                        f+k+lt sd++++g +++p++ ae++       + +++  ++++ +d++ ++W++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F   
  GSVIVT01015035001 126 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfsM-QPPA-QEIVARDLHDNTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFI-- 213
                        99*****************************954.4444.48************************************************.. PP

                        SSSEE..EEEEE-S CS
                 B3  86 grsefelvvkvfrk 99 
                        ++++ +l+++++r+
  GSVIVT01015035001 214 RDEKSQLLLGIRRA 227
                        45677789999997 PP

2Auxin_resp121.37.3e-40252334183
         Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                        aahaa+++s+F+++YnPras+seFv++++k++ka++++vs+GmRf+m+fete+s  rr++Gt++g+s+ld  rW+nS+Wr+L+
  GSVIVT01015035001 252 AAHAAANNSPFTIFYNPRASPSEFVIPLAKYNKAMYTQVSLGMRFRMMFETEESGVRRYMGTITGISELDAARWKNSQWRNLQ 334
                        79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.62E-44116255IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.9E-42118240IPR015300DNA-binding pseudobarrel domain
CDDcd100178.89E-21125226No hitNo description
PfamPF023621.3E-21126227IPR003340B3 DNA binding domain
SMARTSM010191.3E-24126228IPR003340B3 DNA binding domain
PROSITE profilePS5086312.492126228IPR003340B3 DNA binding domain
PfamPF065073.1E-35252334IPR010525Auxin response factor
PfamPF023091.8E-9748837IPR033389AUX/IAA domain
PROSITE profilePS5174526.538751844IPR000270PB1 domain
SuperFamilySSF542771.08E-8766829No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010311Biological Processlateral root formation
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 879 aa     Download sequence    Send to blast
MKAPPNGFLA GSGEGERKSI NSELWHACAG PLVSLPPVGS LVVYFPQGHS EQVAASMQKE  60
TECVPSYPNL PSKLICMLHN VTLHADAETD EVYAQMTLQP VSKYDKEALL ASDLGLKQSR  120
QPVEFFCKTL TASDTSTHGG FSVPRRAAEK IFPPLDFSMQ PPAQEIVARD LHDNTWTFRH  180
IYRGQPKRHL LTTGWSVFVS TKRLFAGDSV LFIRDEKSQL LLGIRRANRQ QPALSSSVIS  240
CDSMHIGILA AAAHAAANNS PFTIFYNPRA SPSEFVIPLA KYNKAMYTQV SLGMRFRMMF  300
ETEESGVRRY MGTITGISEL DAARWKNSQW RNLQVGWDES TAGERPSRVS IWEIEPVVTP  360
FYLCPPPFFR PKFPKQPGFP DDESDIESAF KRGMPWLGDD FGMKDAPSSI FPGLNLVQWM  420
SMQQNNQFPA SQSGLFPPMV SSTVLHSNLS TDDPSKLLSF QAPALSAPSL QFNKVNQQNQ  480
LFQPAFVNGV FSLLVGIHFS CHLCHKTCSF SNKWNSSLAF SSQRPQQPQQ PQVQQSSQQN  540
LPEHQLQLQY LQKLQQQQLL SPVSPRLQPQ QPQQQQANQQ NQSLQHLSLS QQQLSSNSFS  600
TSALMQSQQI PMNQLQGQHK PITAIRAHSG LTDGDAPSCS TSPSTNNCQV PSNFLNRNQQ  660
GPAILLGDSV VEPASNLSNP QSNPPFAVNI DGLTPDTLLD IETELSTAAI SSQSFGVPNM  720
SFKPGCSNDV AITETGVLSN GLWTNQAQRM RTYTKVQKRG SVGRSIDVTR YKGYDELRHD  780
LARMFGIEGQ LEDPQRTDWK LVYVDHENDI LLVGDDPWEE FVSCVQSIKI LSSAEVQQMS  840
LDGDLGHVPV PNQACSGTDS GNAWKGHYED TSAASFNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1721535545388Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010656094.10.0PREDICTED: auxin response factor 7-like isoform X1
SwissprotQ8RYC80.0ARFS_ARATH; Auxin response factor 19
TrEMBLF6HGM90.0F6HGM9_VITVI; Auxin response factor
STRINGVIT_11s0016g00640.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9033914
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19